Yetty Mulinty

Yetty Mulinty

5
Followers
6
Following
Yetty Mulinty
More ideas from Yetty
Assalamualaikum Moms... Hujan-hujan bawaannya pengen ngemil terus nich Moms, akhirnya aku bikin pie brownies yang memang sudah ada di l...

Assalamualaikum Moms... Hujan-hujan bawaannya pengen ngemil terus nich Moms, akhirnya aku bikin pie brownies yang memang sudah ada di l...

Resep Bakso Sehat Kenyal Ala Iwed Yang Pernah Menjadi Viral di Sosmedarwrwsewaeqrwtsyrttypaghskcbmnm16280

Resep Bakso Sehat Kenyal Ala Iwed Yang Pernah Menjadi Viral di Sosmedarwrwsewaeqrwtsyrttypaghskcbmnm16280

Tahu crispy ini rasanya sangat lezat dan unik karena memakai bumbu siraman cabai, bawang dan garam.

Tahu crispy ini rasanya sangat lezat dan unik karena memakai bumbu siraman cabai, bawang dan garam.

Photo of a timber house exterior from real Australian home - House Facade photo 1089893

Photo of a timber house exterior from real Australian home - House Facade photo 1089893

Modal Layered Abaya Almondine color The beauty of this Abaya lies in its simplicity. Add our unbelievably soft Modal fabric, and you‘ve got a winner. The simple details draw your attention to the symmetrical tiers on the skirt: perfectly draped for a graceful and ethereal look. We love this abaya for its versatility- it works just as well for work or school as it does for a more casual outing.  What is Modal? Put simply, Modal is a softer, higher quality version of rayon.

Modal Layered Abaya Almondine color The beauty of this Abaya lies in its simplicity. Add our unbelievably soft Modal fabric, and you‘ve got a winner. The simple details draw your attention to the symmetrical tiers on the skirt: perfectly draped for a graceful and ethereal look. We love this abaya for its versatility- it works just as well for work or school as it does for a more casual outing. What is Modal? Put simply, Modal is a softer, higher quality version of rayon.

Gamis Babydoll Les Resleting  Gamis Bahan Jersey kualitas bagus. Baju gamis terbaru bahan sifon spandek bahan jersey model baju gamis jersey korea murah model baju gamis muslimah jersey polos baju model umbrella payung gamis polos renda motif model pesta syari supplier distributor tanah abang

Gamis Babydoll Les Resleting Gamis Bahan Jersey kualitas bagus. Baju gamis terbaru bahan sifon spandek bahan jersey model baju gamis jersey korea murah model baju gamis muslimah jersey polos baju model umbrella payung gamis polos renda motif model pesta syari supplier distributor tanah abang